PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29957.m001404
Common NameRCOM_1134560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 88aa    MW: 10096.8 Da    PI: 10.7697
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29957.m001404genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS35.51.3e-112478111165
           GRAS 111 rvHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerL 165
                    rvH+ D ++++G+QWpaLlqa++s+++ ++++ i   g++++++ + l+e+g++L
  29957.m001404  24 RVHVTDSSMNHGMQWPALLQAFSSQTRWSARFPINRNGAASHDNLDHLQEVGWKL 78 
                    8*************************************99999***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098510.914188IPR005202Transcription factor GRAS
PfamPF035144.7E-92478IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MCKVATYVAE ALARRIYRLY PKLRVHVTDS SMNHGMQWPA LLQAFSSQTR WSARFPINRN  60
GAASHDNLDH LQEVGWKLGP MILFGKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580029.12e-20PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B
SwissprotQ8S4W79e-19GAI1_VITVI; DELLA protein GAI1
TrEMBLB9RVE47e-62B9RVE4_RICCO; Putative uncharacterized protein
STRINGPOPTR_0008s13090.11e-17(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.12e-17GRAS family protein